Primary Antibodies

Focal adhesion kinase (FAK) is a non receptor protein tyrosine kinase discovered as a substrate for Src and a key element in integrin signaling. FAK plays a central role in cell spreading, differentiation, migration, cell death and acceleration of

ILK (Integrin-Linked Kinase) is an intraceullar Ser/Thr kinase with four Ankyrin-like repeats. It is known to play pivotal roles in extracellular matrix mediated signaling.

Dual specificity mitogen-activated protein kinase kinase 7 (UniProt: O14733 also known as EC:2.7.

Specificity Munc-18, phospho Serine 515. The antibody recognizes a protein of ~65 kDa corresponding to Munc-18, phospho Serine 515 in lysates from rat cortex.

Specificity Recombinant truncated chicken MYPT1 phosphorylated on Thr850. Immunogen Peptide corresponding to amino acid residues 845-855 of chicken MYPT1 this sequence is identical to amino acids 848-858 of human MYPT1, with the phosphorylated Thr

Ribosomal protein S6 kinase alpha-1 (EC 2.7.

ULK1 or autophagy-related protein 1 homolog (ATG1) is a serine/threonine protein kinase. It is a ubiquitously expressed protein that is highly abundant in the brain, skeletal muscle, and heart.

ULK1 or autophagy-related protein 1 homolog (ATG1) is a serine/threonine protein kinase. It is a ubiquitously expressed protein that is highly abundant in the brain, skeletal muscle, and heart.

Immunogen protease inhibitor 15 preproprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

PI15 (peptidase inhibitor 15) is a trypsin-binding protein with a molecular weight of 25 kDa. It is expressed in the brain, placenta and lymphocytes, including neuroblastoma and glioblastoma cell lines.

Immunogen peptidase inhibitor 16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to peptidase inhibitor 16 Sequence TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the