-
HPA030968-100UL
Anti-VTA1 antibody produced in rabbit (C15-1452-917)
Price: $879.43List Price: $977.14Immunogen Vps20-associated 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA030969-100UL
Anti-VTA1 antibody produced in rabbit (C15-1452-918)
Price: $879.43List Price: $977.14Immunogen vesicle (multivesicular body) trafficking 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039710-100UL
Anti-WBP11 antibody produced in rabbit (C15-1455-861)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA040037-100UL
Anti-WBP11 antibody produced in rabbit (C15-1456-032)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA046403-100UL
Anti-WBP11 antibody produced in rabbit (C15-1458-841)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049126-100UL
Anti-WBP11 antibody produced in rabbit (C15-1459-833)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042766-100UL
Anti-WDR17 antibody produced in rabbit (C15-1457-360)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA054501-100UL
Anti-WDR17 antibody produced in rabbit (C15-1461-700)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WD repeat domain 17 Sequence GTPPLLCGKVSRDIRQEIEKLTANSQVKKLRWFSECLSPPGGSDNLWNLVAVIKGQDDSLLPQNYCKGIMHLKHLIKFRTSEAQELTTVKM Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA031752-100UL
Anti-WRNIP1 antibody produced in rabbit (C15-1453-259)
Price: $889.20List Price: $988.00The gene WRNIP1 (werner helicase-interacting protein 1) is mapped to human chromosome 6p25.2. -
HPA031753-100UL
Anti-WRNIP1 antibody produced in rabbit (C15-1453-260)
Price: $889.20List Price: $988.00Immunogen Werner helicase interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
ABE559
Anti-Xrcc1 Antibody (C15-1317-199)
Price: $713.14List Price: $792.38DNA repair protein XRCC1 (X-ray repair cross-complementing protein 1) is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. XRCC1 interacts with DNA ligase III, polymerase -
HPA053727-100UL
Anti-ZCCHC17 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger, CCHC domain containing 17 Sequence MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK Application All Prestige Antibodies Powered by Atlas Antibodies are