-
HPA046033-100UL
Anti-ZDHHC14 antibody produced in rabbit (C15-1458-704)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, DHHC-type containing 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA063754-100UL
Anti-ZDHHC14 antibody produced in rabbit (C15-1464-474)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, DHHC-type containing 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA003618-100UL
Anti-ZDHHC15 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Palmitoyltransferase ZDHHC15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
AV47141-100UL
Anti-ZDHHC17 (AB1) antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human ZDHHC17 Application Anti-ZDHHC17 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL. Biochem/physiol Actions ZDHHC17 is a -
HPA016807-100UL
Anti-ZDHHC17 antibody produced in rabbit (C15-1448-600)
Price: $879.43List Price: $977.14Immunogen Palmitoyltransferase ZDHHC17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA058674-100UL
Anti-ZDHHC17 antibody produced in rabbit (C15-1463-028)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger DHHC-type containing 17 Sequence LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA006672-100UL
Anti-ZKSCAN1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger with KRAB and SCAN domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA009637-100UL
Anti-ZKSCAN3 antibody produced in rabbit (C15-1447-325)
Price: $879.43List Price: $977.14Immunogen zinc finger with KRAB and SCAN domains 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA060116-100UL
Anti-ZKSCAN3 antibody produced in rabbit (C15-1463-455)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger with KRAB and SCAN domains 3 Sequence AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
AV39384-100UL
Anti-ZKSCAN4 antibody produced in rabbit
Price: $898.29List Price: $998.10ZKSCAN4 is a zinc finger protein that has SCAN and KRAB domains. This protein is known to interact with glucocorticoid receptor. -
HPA049906-100UL
Anti-ZKSCAN7 antibody produced in rabbit (C15-1460-125)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 167 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA071850-100UL
Anti-ZKSCAN7 antibody produced in rabbit (C15-1466-115)
Price: $928.29List Price: $1,031.43Immunogen zinc finger with KRAB and SCAN domains 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive