Primary Antibodies

Immunogen Recombinant protein corresponding to Acyl-CoA synthetase long-chain family member 5. Sequence VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK Epitope Binds to an epitope located within

Immunogen Actin beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Monoclonal Anti-&#945-Sarcomeric Actin (mouse IgM isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Actin is one of the most conserved eukaryotic proteins and the isoforms

Monoclonal Anti-&#945-Sarcomeric Actin (mouse IgM isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Actin is one of the most conserved eukaryotic proteins and the isoforms

Actin and myosin are major cytoskeletal proteins. Actin is expressed majorly in six isoforms.

Actin and myosin are major cytoskeletal proteins. Actin is expressed majorly in six isoforms.

&#945-smooth muscle actin, a smooth muscle cell-specific protein, is also known as aortic smooth muscle or a smooth muscle actin (&#945-SMA, SMactin, &#945-SM-actin, ASMA). It belongs to the actin family.

&#945-smooth muscle actin, a smooth muscle cell-specific protein, is also known as aortic smooth muscle or a smooth muscle actin (&#945-SMA, SMactin, &#945-SM-actin, ASMA). It belongs to the actin family.

Actin is a highly conserved protein that is a major component of both the cytoskeletal and contractile structures in all cell types. Its expression is related to the type of differentiation and to the functional state of cells and tissues.

Monoclonal Anti-Actin (mouse IgG2a isotype) is derived from the AC-40 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Actin has six isoforms.

Monoclonal Anti-Actin (mouse IgG2a isotype) is derived from the AC-40 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice.&nbspIt has one N-terminal region which appears to be a major antigenic region and may

Immunogen adhesion G protein-coupled receptor L4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive