-
Add to Cart The item has been addedAMAB90530-100ULMonoclonal Anti-APOL1 antibody produced in mouse (C15-1318-444)
Price: $977.14List Price: $1,085.71Immunogen apolipoprotein L, 1 recombinant protein epitope signature tag (PrEST) Sequence SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN Epitope Binds to an epitope -
Add to Cart The item has been addedAMAB90532-100ULMonoclonal Anti-APOL1 antibody produced in mouse (C15-1318-445)
Price: $977.14List Price: $1,085.71Immunogen apolipoprotein L, 1 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal -
Add to Cart The item has been addedAMAB90545-100ULMonoclonal Anti-ARG1 antibody produced in mouse (C15-1318-450)
Price: $977.14List Price: $1,085.71Immunogen arginase, liver recombinant protein epitope signature tag (PrEST) Sequence TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA Epitope Binds to an epitope located within -
Add to Cart The item has been addedA5979-100ULMonoclonal Anti-ARP3 antibody produced in mouse (C15-1315-310)
Price: $891.43List Price: $990.48Monoclonal Anti-ARP3 (mouse IgG2b isotype) is derived from the hybridoma FMS338 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with recombinant human ARP3. Arp3 is mapped to human chromosome -
Add to Cart The item has been addedA5979-200ULMonoclonal Anti-ARP3 antibody produced in mouse (C15-1315-311)
Price: $1,177.71List Price: $1,308.57Monoclonal Anti-ARP3 (mouse IgG2b isotype) is derived from the hybridoma FMS338 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with recombinant human ARP3. Arp3 is mapped to human chromosome -
Add to Cart The item has been addedA5979-25ULMonoclonal Anti-ARP3 antibody produced in mouse (C15-1315-312)
Price: $314.08List Price: $348.98Monoclonal Anti-ARP3 (mouse IgG2b isotype) is derived from the hybridoma FMS338 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with recombinant human ARP3. Arp3 is mapped to human chromosome -
Add to Cart The item has been addedAMAB90907-100ULMonoclonal Anti-ASRGL1 antibody produced in mouse (C15-1318-596)
Price: $977.14List Price: $1,085.71Immunogen asparaginase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB90909-100ULMonoclonal Anti-ATF3 antibody produced in mouse (C15-1318-597)
Price: $977.14List Price: $1,085.71Immunogen activating transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedB9277-.2MLMonoclonal Anti-Band 3 antibody produced in mouse (C15-1343-061)
Price: $1,126.29List Price: $1,251.43Band 3 is a hydrophobic protein, it exists in erythrocytes as a dimer and tetramer and has a strong tendency to aggregate because of oxidative stress. Band 3 is an anion exchanger that is abundantly found in erythrocyte membranes. -
Add to Cart The item has been addedB9277-100ULMonoclonal Anti-Band 3 antibody produced in mouse (C15-1343-062)
Price: $855.43List Price: $950.48Band 3 is a hydrophobic protein, it exists in erythrocytes as a dimer and tetramer and has a strong tendency to aggregate because of oxidative stress. Band 3 is an anion exchanger that is abundantly found in erythrocyte membranes. -
Add to Cart The item has been addedA2228-100ULMonoclonal Anti-beta-Actin antibody produced in mouse (C15-1314-958)
Price: $867.43List Price: $963.81ACTB (actin β) gene codes for β-actin. It is a cytoskeletal housekeeping protein. -
Add to Cart The item has been addedA2228-200ULMonoclonal Anti-beta-Actin antibody produced in mouse (C15-1314-959)
Price: $1,121.14List Price: $1,245.71ACTB (actin β) gene codes for β-actin. It is a cytoskeletal housekeeping protein.
