Primary Antibodies

Prepared by conjugation of fluorescein isothiocyanate isomer 1 (FITC). This green dye is efficiently excited at 495 nm and emits at 525 nm.

Immunogen CD68 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen CD68 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Monoclonal Anti-Human CD8 (mouse IgG2a isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cell line NS-1 and splenocytes from BALB/c mice immunized with human thymocytes followed by peripheral blood T cells. CD8 (cluster

Immunogen Recombinant protein corresponding to CD8a molecule Sequence AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT Epitope Binds to an epitope located within the peptide sequence AASPTFLLYLSQNKP as determined

Immunogen cadherin 1, type 1, E-cadherin (epithelial) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CDH1 (cadherin 1) codes for a transmembrane glycoprotein E-cadherin that is located on human chromosome 16q22.1.

Immunogen cadherin 1, type 1, E-cadherin (epithelial) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to Cyclin dependent kinase 2 Sequence DYKPSFPKWARQDFSKVVPPLDED Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to Cyclin dependent kinase 4 Sequence LPPEDDWPRDVSLPRGAFP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Cdk4 exists, in part, as a multi-protein complex with a D-type cyclin, proliferating cell nuclear antigen (PCNA) and a protein inhibitor, p21 Cip1 . Cdk4 associates separately with p16, particularly in cells lacking a functional retinoblastoma

Immunogen CDK5 regulatory subunit associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive