-
Add to Cart The item has been addedC7089-.2MLMonoclonal Anti-Cdk7/CAK antibody produced in mouse
Price: $860.57List Price: $956.19Cell division protein kinase 7 is an enzymes encoded by the CDK7 gene in humans. The protein belongs to cyclin-dependent protein kinase (CDK) family. -
Add to Cart The item has been addedAMAB91322-100ULMonoclonal Anti-CDKL5 antibody produced in mouse (C15-1318-787)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to CAP-GLY domain containing linker protein 1. Sequence AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP Application All Prestige -
Add to Cart The item has been addedAMAB91323-100ULMonoclonal Anti-CDKL5 antibody produced in mouse (C15-1318-788)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to CAP-GLY domain containing linker protein 1. Sequence AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP Application All Prestige -
Add to Cart The item has been addedAMAB91129-100ULMonoclonal Anti-CHAT antibody produced in mouse (C15-1318-696)
Price: $977.14List Price: $1,085.71Immunogen choline O-acetyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91130-100ULMonoclonal Anti-CHAT antibody produced in mouse (C15-1318-697)
Price: $977.14List Price: $1,085.71Choline O-acetyltransferase (CHAT) gene is mapped to human chromosome 10q11.23. -
Add to Cart The item has been addedAMAB90525-100ULMonoclonal Anti-CHGA antibody produced in mouse (C15-1318-442)
Price: $977.14List Price: $1,085.71Immunogen chromogranin A (parathyroid secretory protein 1) recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedC9358-.2MLMonoclonal Anti-Chk1 antibody produced in mouse
Price: $877.71List Price: $975.24Checkpoint kinase 1 (Chk1) protein is a serine/threonine-protein kinase with a molar mass of 54 kDa. Monoclonal Anti-Chk1 (mouse IgG2b isotype) is derived from the DCS-310 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from -
Add to Cart The item has been addedC5922-.2MLMonoclonal Anti-CNPase antibody produced in mouse (C15-1346-660)
Price: $1,126.29List Price: $1,251.43CNPase (2′,3′-cyclic nucleotide 3′-phosphodiesterase, E.C. -
Add to Cart The item has been addedC5922-100ULMonoclonal Anti-CNPase antibody produced in mouse (C15-1346-661)
Price: $855.43List Price: $950.48CNPase (2′,3′-cyclic nucleotide 3′-phosphodiesterase, E.C. -
Add to Cart The item has been addedC1862-200ULMonoclonal Anti-Coilin antibody produced in mouse
Price: $1,150.29List Price: $1,278.10Monoclonal Anti-Coilin (mouse IgG1 isotype) is derived from the pδ hybridoma produced by the fusion of mouse myeloma cells and splenocytes from mice immunized with coilin. Coilin contains two nuclear localization sequences (NLS) (at amino acid -
Add to Cart The item has been addedC2456-.2MLMonoclonal Anti-Collagen, Type I antibody produced in mouse (C15-1346-456)
Price: $1,126.29List Price: $1,251.43Collagen type I contributes maximum to the fibrous protein content in mammals. It is also present in arteries and extracellular matrix. -
Add to Cart The item has been addedC2456-.5MLMonoclonal Anti-Collagen, Type I antibody produced in mouse (C15-1346-457)
Price: $2,142.86List Price: $2,380.95Collagen type I contributes maximum to the fibrous protein content in mammals. It is also present in arteries and extracellular matrix.
