Primary Antibodies

Collagen type I contributes maximum to the fibrous protein content in mammals. It is also present in arteries and extracellular matrix.

Collagen is a fibrous protein present in the extracellular framework of all vertebrates. Collagen type III is a 300 kD molecule that belongs to fibrillar collagens family found mainly in skin, blood vessels, liver, placenta, tongue and thymus.

Collagen is a fibrous protein present in the extracellular framework of all vertebrates. Collagen type III is a 300 kD molecule that belongs to fibrillar collagens family found mainly in skin, blood vessels, liver, placenta, tongue and thymus.

Monoclonal Anti-Collagen Type IV (mouse IgG1 isotype) is derived from the COL-94 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with human collagen Type IV. The composition of the extracellular

Monoclonal Anti-Collagen Type IV (mouse IgG1 isotype) is derived from the COL-94 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with human collagen Type IV. The composition of the extracellular

Collagen is a fibrous protein present in the extracellular framework of all vertebrates. Collagen type VII is the crucial component of anchoring fibrils and mutation in type VII collagen gene (COL7A1) leads to epidermolysis bullosa dystrophica.

Collagen is a fibrous protein present in the extracellular framework of all vertebrates. Collagen type VII is the crucial component of anchoring fibrils and mutation in type VII collagen gene (COL7A1) leads to epidermolysis bullosa dystrophica.

Collagen is a fibrous protein present in the extracellular framework of all vertebrates. Collagen type VII is the crucial component of anchoring fibrils and mutation in type VII collagen gene (COL7A1) leads to epidermolysis bullosa dystrophica.

Collagens are extracellular glycoproteins made up of three polypeptides that intermingle to form a triple helix. Type X collagen is a homotrimer of 59 kD &#9451(X) chains found in fetal hypertrophic cartilage in the growth zones of long bones,

Collagens are extracellular glycoproteins made up of three polypeptides that intermingle to form a triple helix. Type X collagen is a homotrimer of 59 kD &#9451(X) chains found in fetal hypertrophic cartilage in the growth zones of long bones,

Immunogen Recombinant protein corresponding to carboxypeptidase A1 Sequence DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Recombinant protein corresponding to carboxypeptidase A1 Sequence DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the