-
Add to Cart The item has been addedAMAB91005-100ULMonoclonal Anti-CS antibody produced in mouse (C15-1318-633)
Price: $977.14List Price: $1,085.71Monoclonal Anti-CS Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Citrate -
Add to Cart The item has been addedAMAB91006-100ULMonoclonal Anti-CS antibody produced in mouse (C15-1318-634)
Price: $977.14List Price: $1,085.71Monoclonal Anti-CS Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Citrate -
Add to Cart The item has been addedAMAB91007-100ULMonoclonal Anti-CS antibody produced in mouse (C15-1318-636)
Price: $977.14List Price: $1,085.71Monoclonal Anti-CS Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Citrate -
Add to Cart The item has been addedAMAB91008-100ULMonoclonal Anti-CS antibody produced in mouse (C15-1318-637)
Price: $977.14List Price: $1,085.71Monoclonal Anti-CS Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Citrate -
Add to Cart The item has been addedAMAB91009-100ULMonoclonal Anti-CS antibody produced in mouse (C15-1318-638)
Price: $977.14List Price: $1,085.71Monoclonal Anti-CS Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Citrate -
Add to Cart The item has been addedAMAB91366-100ULMonoclonal Anti-CTGF antibody produced in mouse (C15-1318-812)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to connective tissue growth factor Sequence LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedAMAB91209-100ULMonoclonal Anti-CTNNB1 antibody produced in mouse (C15-1318-730)
Price: $977.14List Price: $1,085.71Immunogen catenin (cadherin-associated protein), beta 1, 88kDa Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by -
Add to Cart The item has been addedAMAB91210-100ULMonoclonal Anti-CTNNB1 antibody produced in mouse (C15-1318-731)
Price: $977.14List Price: $1,085.71Immunogen catenin (cadherin-associated protein), beta 1, 88kDa Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by -
Add to Cart The item has been addedC6223-.5MGMonoclonal Anti-CXCR-1 (IL-8 RA) antibody produced in mouse
Price: $1,702.29List Price: $1,891.43Chemokine receptor CXCR1 also refers as type I IL-8 receptor or IL-8RA is a class A, rhodopsin-like G-protein-coupled receptor, expressed mainly in neutrophils but not in T or B lymphocytes . It has a crucial role in cellular signal transduction -
Add to Cart The item has been addedC4710-.2MLMonoclonal Anti-Cyclin A antibody produced in mouse
Price: $881.14List Price: $979.05Cyclin A is a nuclear protein during S phase and it binds both cdk2 and cdc2. The availability of monoclonal antibody reacting specifically with cyclin A enables the subcellular detection and localization of cyclin A and the measurement of relative -
Add to Cart The item has been addedC7464-.5MLMonoclonal Anti-Cyclin D1 antibody produced in mouse
Price: $1,021.71List Price: $1,135.24Monoclonal Anti-Cyclin D 1 (mouse IgG2a isotype) is derived from the DCS-6 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Cyclin D 1 protein is a G 1 -phase cyclin in mammalian cells. -
Add to Cart The item has been addedC0791-100ULMonoclonal Anti-Cytokeratin Peptide 13 antibody produced in mouse
Price: $771.43List Price: $857.14Specificity The antibody reacts with squamous, non-keratinized epithelium, transitional epithelium, pseudostratified epithelium, and myoepithelium. Immunogen cultured human epidermoid carcinoma cell line A-431.
