Primary Antibodies

Immunogen dopa decarboxylase (aromatic L-amino acid decarboxylase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Monoclonal Anti-Death Associated Protein (DAP) Kinase (mouse IgG1 isotype) is derived from the DAPK-55 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice. Death-associated protein 1 (DAP1) gene is mapped to

Immunogen dicer 1, ribonuclease type III Application All Prestige Antibodies &#174 Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds

Dicer is a member of the RNase III family containing an N-terminal DEXH-box RNA helicase/ATPase domain, followed by a domain of unknown function (DUF283), a PAZ domain, which anchors the 3&#8242-end of the guided siRNA, two RNase III domains, and

Monoclonal Anti-Dynein (Heavy Chain) (mouse IgG2a isotype) is derived from the 440.4 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice.

Dynein is a multimeric motor protein which transports membrane-bound vesicles, proteins and organelles towards the negative end of microtubules (retrograde transport). It has a crucial role in cytoplasmic motility, chromosomal movement and the

Immunogen recombinant dynein 1 light chain-myosin basic protein fusion protein. Application Monoclonal Anti-DYNLT1 antibody produced in mouse is suitable for immunocytochemistry and immunoblotting at a working concentration of 8-16&#956g/mL using

Immunogen Recombinant protein corresponding to ephrin A1 Sequence RHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

ELKS/RAB6-interacting/CAST family member 1 is a protein encoded by the ERC1 gene in humans. It encodes for a synaptic factor and is found in the smallest region of overlap.

Immunogen Recombinant protein corresponding to Emerin. Sequence ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSACQSITHY Epitope Binds to an epitope located within the peptide sequence

Immunogen Recombinant protein corresponding to Emerin. Sequence ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSACQSITHY Epitope Binds to an epitope located within the peptide sequence

Monoclonal Anti-endothelial cell protein C receptor (EPCR) (rat IgG2a isotype) is derived from the RCR379 hybridoma produced by the fusion of mouse SP2/0 myeloma cells and lymphatic cells isolated from the superficial inguinal lymph nodes from