Primary Antibodies

Endothelin consists of a family of potent vasoconstrictor peptides, which include four structurally related isoforms, ET-1, ET-2, ET-3 and vasointestinal contractor (VIC, &#946 -ET) Specificity The antibody shows little cross-reactivity to related

Immunogen endoglin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen Recombinant protein corresponding to Epithelial cell adhesion molecule Sequence NGSKLGRRAKPEGALQNND Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Recombinant protein corresponding to Epithelial cell adhesion molecule Sequence NGSKLGRRAKPEGALQNND Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen estrogen receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen fatty acid binding protein 7, brain recombinant protein epitope signature tag (PrEST) Sequence MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK Epitope Binds to an epitope located within the peptide

Four and a half LIM domains protein 1 is a protein encoded by the FHL1 gene in human and located on human chromosome Xq27.2.

Monoclonal Anti-Factor V (mouse IgG1 isotype) is derived from the HV-1 hybridoma, produced by the fusion of mouse myeloma Sp2/0-Ag14 cells and splenocytes from BALB/c mouse immunized with Factor V, purified from human plasma. Blood coagulation

Factor X is the vitamin K-dependent pro-coagulants with molecular weight of 68,000. It is synthesized in the liver and consists of a heavy chain and a light chain which are linked by a disulfide bond.

Immunogen fibulin 1, recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most