Primary Antibodies

Monoclonal Anti-iASPP (mouse IgG1 isotype) is derived from the hybridoma LXO49, produced by the fusion of mouse myeloma cells (SP2/0 cells) and splenocytes from BALB/c mice immunized with a recombinant protein encoding residues of human iASPP. The

Immunogen Recombinant protein corresponding to Isocitrate dehydrogenase 1 (NADP+). Sequence FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY Epitope Binds to an epitope located within the peptide sequence IEDFAHSSFQMALSK as

The gene IFI-16 (interferon, &#947-inducible protein 16) encodes a member of the interferon-inducible nuclear proteins family containing one or two copies of a conserved 200 amino acid repeat domain called HIN-200 domain. It has three different

Immunogen Recombinant protein corresponding to Interleukin 4 induced 1 Sequence SFRRPFWREEHIEGGHSNTDRPSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Monoclonal Anti-ILK (mouse IgG2b isotype) is derived from the 65.1 hybridoma produced by the fusion of mouse myeloma cells (P3X63-Ag8.

Immunogen Recombinant protein corresponding to inhibin beta C subunit Sequence TPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQRPTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to inhibin beta C subunit Sequence TPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQRPTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

The effects of insulin-like growth factors (IGF) are modulated by a family of insulin-like growth factor binding proteins 1-6. (IGFBPs -1-6).

Interleukin-10 (IL-10) is a pleotropic cytokine with anti-inflammatory and immunosuppressive functions. It is the key cytokine that regulates the host inflammatory responses to bacterial, fungal and viral pathogens.

The antibody will neutralize the biological activity of recombinant human IL-18 receptor. Immunogen recombinant human IL-18 receptor extracellular domain, expressed in NS0 cells.

Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4R&#945 and common

The gene ICAM3 (intercellular adhesion molecule 3) encodes type I membrane glycoprotein that belongs to the immunoglobulin (ig) superfamily. The encoded protein is extensively glycosylated and contains five Ig-like domains that share high homology