-
Add to Cart The item has been addedAMAB91530-100ULMONOCLONAL ANTI-KRT7 ANTIBODY PRODUCED IN MOUSE (C15-1318-897)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to keratin 7 Sequence RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Epitope Binds to an epitope located within the peptide sequence -
Add to Cart The item has been addedAMAB91531-100ULMONOCLONAL ANTI-KRT7 ANTIBODY PRODUCED IN MOUSE (C15-1318-898)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to keratin 7 Sequence RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Epitope Binds to an epitope located within the peptide sequence -
Add to Cart The item has been addedAMAB91136-100ULMonoclonal Anti-LAMC1 antibody produced in mouse (C15-1318-700)
Price: $977.14List Price: $1,085.71Immunogen laminin, gamma 1 (formerly LAMB2) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91137-100ULMonoclonal Anti-LAMC1 antibody produced in mouse (C15-1318-701)
Price: $977.14List Price: $1,085.71Immunogen laminin, gamma 1 (formerly LAMB2) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91138-100ULMonoclonal Anti-LAMC1 antibody produced in mouse (C15-1318-702)
Price: $977.14List Price: $1,085.71Immunogen laminin, gamma 1 (formerly LAMB2) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91140-100ULMonoclonal Anti-LAMC1 antibody produced in mouse (C15-1318-703)
Price: $977.14List Price: $1,085.71Immunogen laminin, gamma 1 (formerly LAMB2) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91168-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-717)
Price: $977.14List Price: $1,085.71The gene LAMP1 (lysosomal-associated membrane protein 1) encodes a type I transmembrane protein that has a short cytoplasmic tail containing a lysosome-targeting signal of GYQTI(382)-COOH. The gene is mapped to human chromosome 13q34. -
Add to Cart The item has been addedAMAB91170-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-718)
Price: $977.14List Price: $1,085.71The gene LAMP1 (lysosomal-associated membrane protein 1) encodes a type I transmembrane protein has a short cytoplasmic tail containing a lysosome-targeting signal of GYQTI(382)-COOH. The gene is mapped to human chromosome 13q34. -
Add to Cart The item has been addedAMAB91298-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-772)
Price: $977.14List Price: $1,085.71Immunogen Lysosomal associated membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91299-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-773)
Price: $977.14List Price: $1,085.71Immunogen Lysosomal associated membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91300-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-774)
Price: $977.14List Price: $1,085.71Immunogen Lysosomal associated membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91301-100ULMonoclonal Anti-LAMP1 antibody produced in mouse (C15-1318-775)
Price: $977.14List Price: $1,085.71Immunogen Lysosomal associated membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
