-
Add to Cart The item has been addedL0669-500UGMonoclonal Anti-Leukemia Inhibitory Factor antibody produced in mouse
Price: $1,702.29List Price: $1,891.43Immunogen purified, E. coli -derived recombinant human leukemia inhibitory factor. -
Add to Cart The item has been addedAMAB91251-100ULMonoclonal Anti-LMNB1 antibody produced in mouse (C15-1318-748)
Price: $977.14List Price: $1,085.71Immunogen Lamin b1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedC268-100ULMonoclonal Anti-m-Calpain (Domain III/IV) antibody produced in mouse
Price: $1,260.00List Price: $1,400.00Calpain-2 catalytic subunit is a protein encoded by the CAPN2 gene in humans. Calpains are calcium dependent proteases constituting a family of proteins that are involved in essential cellular functions mediated by calcium. -
Add to Cart The item has been addedAMAB90832-100ULMonoclonal Anti-MACC1 antibody produced in mouse (C15-1318-558)
Price: $977.14List Price: $1,085.71Immunogen metastasis associated in colon cancer 1, recombinant protein epitope signature tag (PrEST) Sequence FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedAMAB91062-100ULMonoclonal Anti-MBP antibody produced in mouse (C15-1318-662)
Price: $977.14List Price: $1,085.71Immunogen myelin basic protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91063-100ULMonoclonal Anti-MBP antibody produced in mouse (C15-1318-663)
Price: $977.14List Price: $1,085.71Immunogen myelin basic protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91064-100ULMonoclonal Anti-MBP antibody produced in mouse (C15-1318-664)
Price: $977.14List Price: $1,085.71Immunogen myelin basic protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91189-100ULMonoclonal Anti-MCU antibody produced in mouse (C15-1318-724)
Price: $977.14List Price: $1,085.71Immunogen mitochondrial calcium uniporter Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAMAB91275-100ULMonoclonal Anti-METTL14 antibody produced in mouse (C15-1318-764)
Price: $977.14List Price: $1,085.71Immunogen methyltransferase like 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91276-100ULMonoclonal Anti-METTL14 antibody produced in mouse (C15-1318-765)
Price: $977.14List Price: $1,085.71Immunogen methyltransferase like 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB90870-100ULMonoclonal Anti-MKI67 antibody produced in mouse (C15-1318-577)
Price: $977.14List Price: $1,085.71Immunogen antigen identified by monoclonal antibody Ki-67, recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90961-100ULMonoclonal Anti-MKI67IP antibody produced in mouse (C15-1318-610)
Price: $977.14List Price: $1,085.71Monoclonal Anti-MKI67IP Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Nucleolar
