-
Add to Cart The item has been addedAMAB91285-100ULMonoclonal Anti-MKL1 antibody produced in mouse (C15-1318-768)
Price: $977.14List Price: $1,085.71Immunogen megakaryoblastic leukemia (translocation) 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB90804-100ULMonoclonal Anti-MMP9 antibody produced in mouse (C15-1318-551)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase. Sequence -
Add to Cart The item has been addedAMAB90805-100ULMonoclonal Anti-MMP9 antibody produced in mouse (C15-1318-552)
Price: $977.14List Price: $1,085.71Immunogen matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90806-100ULMonoclonal Anti-MMP9 antibody produced in mouse (C15-1318-553)
Price: $977.14List Price: $1,085.71Immunogen matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAMAB90746-100ULMonoclonal Anti-MRC1 antibody produced in mouse (C15-1318-524)
Price: $977.14List Price: $1,085.71The previously assigned protein identifier Q5VSK2 has been merged into P22897. Full details can be found on the UniProt database. -
Add to Cart The item has been addedAMAB90766-100ULMonoclonal Anti-MST1R antibody produced in mouse (C15-1318-529)
Price: $977.14List Price: $1,085.71Immunogen macrophage stimulating 1 receptor (c-met-related tyrosine kinase) Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by -
Add to Cart The item has been addedC0355-.1MGMonoclonal Anti-mu-Calpain, Large Subunit antibody produced in mouse
Price: $905.14List Price: $1,005.71Immunogen purified calpain from human placenta. Physical form Solution containing phosphate buffered saline, ≤ 0. -
Add to Cart The item has been addedAMAB91056-100ULMonoclonal Anti-MUC16 antibody produced in mouse (C15-1318-660)
Price: $977.14List Price: $1,085.71Immunogen Mucin 16, cell surface associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91057-100ULMonoclonal Anti-MUC16 antibody produced in mouse (C15-1318-661)
Price: $977.14List Price: $1,085.71Immunogen Mucin 16, cell surface associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91539-100ULMONOCLONAL ANTI-MUC5AC ANTIBODY PRODUCED IN MOUSE (C15-1318-901)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Mucin 5ac, oligomeric mucus/gel-forming Sequence SPGPHGGDKETYNNIIRSGEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedAMAB90947-100ULMonoclonal Anti-MYH6 antibody produced in mouse (C15-1318-604)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to myosin, heavy chain 6, cardiac muscle, alpha Sequence QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA -
Add to Cart The item has been addedAMAB90948-100ULMonoclonal Anti-MYH6 antibody produced in mouse (C15-1318-605)
Price: $977.14List Price: $1,085.71Monoclonal Anti-MYH6 Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Myosin, heavy
