-
Add to Cart The item has been addedAMAB90798-100ULMonoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-547)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB90800-100ULMonoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-548)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB90801-100ULMonoclonal Anti-NECAB1 antibody produced in mouse (C15-1318-549)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 1. Sequence LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP Epitope Binds to an epitope located within the peptide sequence SIQWPGKRSS as -
Add to Cart The item has been addedAMAB91027-100ULMonoclonal Anti-NEFM antibody produced in mouse (C15-1318-649)
Price: $977.14List Price: $1,085.71Immunogen neurofilament, medium polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91028-100ULMonoclonal Anti-NEFM antibody produced in mouse (C15-1318-650)
Price: $977.14List Price: $1,085.71Immunogen neurofilament, medium polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91029-100ULMonoclonal Anti-NEFM antibody produced in mouse (C15-1318-651)
Price: $977.14List Price: $1,085.71Immunogen neurofilament, medium polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91030-100ULMonoclonal Anti-NEFM antibody produced in mouse (C15-1318-652)
Price: $977.14List Price: $1,085.71Neurofilament medium (NEFM) gene encodes neurofilament medium polypeptide which constitutes to cytoskeleton of mature neurons. The gene in human chromosome is localized on 8p21. -
Add to Cart The item has been addedAMAB91116-100ULMonoclonal Anti-NET antibody produced in mouse (C15-1318-690)
Price: $977.14List Price: $1,085.71Sodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12. -
Add to Cart The item has been addedAMAB90569-100ULMonoclonal Anti-NLRP3 antibody produced in mouse (C15-1318-458)
Price: $977.14List Price: $1,085.71Immunogen NLR family, pyrin domain containing 3 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against -
Add to Cart The item has been addedAMAB91013-100ULMonoclonal Anti-NOP56 antibody produced in mouse (C15-1318-641)
Price: $977.14List Price: $1,085.71Monoclonal Anti-NOP56 Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen NOP56 -
Add to Cart The item has been addedAMAB91540-100ULMONOCLONAL ANTI-NR5A1 ANTIBODY PRODUCED IN MOUSE (C15-1318-902)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Nuclear receptor subfamily 5 group a member 1 Sequence PYGYPEPFSGGPNVP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedAMAB90889-100ULMonoclonal Anti-OCLN antibody produced in mouse (C15-1318-587)
Price: $977.14List Price: $1,085.71Immunogen occludin, recombinant protein epitope signature tag (PrEST) Sequence DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED Epitope Binds to an epitope
