-
Add to Cart The item has been addedAMAB91514-100ULMONOCLONAL ANTI-PIK3CA ANTIBODY PRODUCED IN MOUSE (C15-1318-891)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha Sequence SYSHAGLSNRLARDNELRENDKEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedAMAB91585-100ULMONOCLONAL ANTI-PIK3CB ANTIBODY PRODUCED IN MOUSE (C15-1318-924)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta Sequence KQTYPPEHEPSIPENLEDK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedAMAB91515-100ULMONOCLONAL ANTI-PLK1 ANTIBODY PRODUCED IN MOUSE (C15-1318-892)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Polo like kinase 1 Sequence SNRKPLTVLNKGLENPLPERPREK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedAMAB91477-100ULMONOCLONAL ANTI-POU5F1 ANTIBODY PRODUCED IN MOUSE (C15-1318-874)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Pou class 5 homeobox 1 Sequence KEKLEQNPEESQDIKALQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAMAB91329-100ULMonoclonal Anti-PRAME antibody produced in mouse (C15-1318-792)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to preferentially expressed antigen in melanoma. Sequence LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI Epitope Binds to an -
Add to Cart The item has been addedAMAB91330-100ULMonoclonal Anti-PRAME antibody produced in mouse (C15-1318-793)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to tyrosinase-related protein 1. Sequence LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI Application All Prestige Antibodies -
Add to Cart The item has been addedAMAB91494-100ULMONOCLONAL ANTI-PROM1 ANTIBODY PRODUCED IN MOUSE (C15-1318-883)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Prominin 1 Sequence QPSSTDAPKAWNYELPATNYETQD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedA2556-.2MLMonoclonal Anti-Rabbit IgG (gamma-chain specific)-Alkaline Phosphatase antibody produced in mouse (C15-1314-984)
Price: $334.29List Price: $371.43Monoclonal Anti-Rabbit IgG (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Immunoglobulin G (IgG) belongs to the immunoglobulin family and is a widely -
Add to Cart The item has been addedAMAB91288-100ULMonoclonal Anti-RBCK1 antibody produced in mouse (C15-1318-769)
Price: $977.14List Price: $1,085.71Immunogen RanBP-type and C3HC4-type zinc finger containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB90740-100ULMonoclonal Anti-REST antibody produced in mouse (C15-1318-523)
Price: $977.14List Price: $1,085.71Immunogen RE1-silencing transcription factor, recombinant protein epitope signature tag (PrEST) Sequence SPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAEEADESLPGLAANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLTGINSTVEEPVSPMLPPSAVEEREAVSKTALA Epitope Binds -
Add to Cart The item has been addedAMAB91377-100ULMonoclonal Anti-RGS5 antibody produced in mouse (C15-1318-816)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Regulator of g-protein signaling 5 Sequence GDLVIPYNEKPEKPAKTQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedAMAB90596-100ULMonoclonal Anti-S100A4 antibody produced in mouse (C15-1318-470)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to S100 calcium binding protein A4. Sequence MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Epitope Binds to an epitope located within the peptide
