-
Add to Cart The item has been addedAMAB91594-100ULMONOCLONAL ANTI-SMAD4 ANTIBODY PRODUCED IN MOUSE (C15-1318-929)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to SMAD family member 4 Sequence AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI Epitope Binds to an epitope located within the -
Add to Cart The item has been addedAMAB91280-100ULMonoclonal Anti-SMCHD1 antibody produced in mouse (C15-1318-766)
Price: $977.14List Price: $1,085.71Immunogen structural maintenance of chromosomes flexible hinge domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAMAB91282-100ULMonoclonal Anti-SMCHD1 antibody produced in mouse (C15-1318-767)
Price: $977.14List Price: $1,085.71Immunogen structural maintenance of chromosomes flexible hinge domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAMAB91428-100ULMonoclonal Anti-SORT1 antibody produced in mouse (C15-1318-846)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to sortilin 1 Sequence LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedAMAB91297-100ULMonoclonal Anti-SOX10 antibody produced in mouse (C15-1318-771)
Price: $977.14List Price: $1,085.71Immunogen SRY (sex determining region Y)-box 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB90501-100ULMonoclonal Anti-SOX11 antibody produced in mouse (C15-1318-434)
Price: $977.14List Price: $1,085.71Immunogen SRY (sex determining region Y)-box 11 recombinant protein epitope signature tag (PrEST) Sequence FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK Epitope Binds to an epitope -
Add to Cart The item has been addedAMAB90502-100ULMonoclonal Anti-SOX11 antibody produced in mouse (C15-1318-435)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to SRY (sex determining region Y)-box 11. Sequence FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK Epitope Binds to an epitope located -
Add to Cart The item has been addedAMAB91312-100ULMonoclonal Anti-SOX3 antibody produced in mouse (C15-1318-782)
Price: $977.14List Price: $1,085.71Immunogen SRY (sex determining region Y)-box 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91378-100ULMonoclonal Anti-SOX4 antibody produced in mouse (C15-1318-817)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Sry-box 4 Sequence AGADPSDPLGLYEEEGAG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAMAB91380-100ULMonoclonal Anti-SOX4 antibody produced in mouse (C15-1318-819)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Sry-box 4 Sequence AGADPSDPLGLYEEEGAG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAMAB91218-100ULMonoclonal Anti-ST13 antibody produced in mouse (C15-1318-734)
Price: $977.14List Price: $1,085.71Immunogen suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
Add to Cart The item has been addedAMAB90776-100ULMonoclonal Anti-STAT3 antibody produced in mouse (C15-1318-536)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to signal transducer and activator of transcription 3 (acute-phase response factor). Sequence
