-
Add to Cart The item has been addedAMAB90777-100ULMonoclonal Anti-STAT3 antibody produced in mouse (C15-1318-537)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to signal transducer and activator of transcription 3 (acute-phase response factor). Sequence -
Add to Cart The item has been addedAMAB90523-100ULMonoclonal Anti-TG antibody produced in mouse (C15-1318-441)
Price: $977.14List Price: $1,085.71Immunogen thyroglobulin recombinant protein epitope signature tag (PrEST) Sequence KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS -
Add to Cart The item has been addedAMAB91112-100ULMonoclonal Anti-TH antibody produced in mouse (C15-1318-689)
Price: $977.14List Price: $1,085.71Immunogen tyrosine hydroxylase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAMAB91233-100ULMonoclonal Anti-THSD7A antibody produced in mouse (C15-1318-741)
Price: $977.14List Price: $1,085.71Immunogen thrombospondin, type I, domain containing 7A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91234-100ULMonoclonal Anti-THSD7A antibody produced in mouse (C15-1318-742)
Price: $977.14List Price: $1,085.71Immunogen thrombospondin, type I, domain containing 7A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91188-100ULMonoclonal Anti-TLE3 antibody produced in mouse (C15-1318-723)
Price: $977.14List Price: $1,085.71Immunogen transducin-like enhancer of split 3 (E(sp1) homolog, Drosophila) Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by -
Add to Cart The item has been addedAMAB91224-100ULMONOCLONAL ANTI-TP63 ANTIBODY PRODUCED IN MOUSE (C15-1318-737)
Price: $977.14List Price: $1,085.71Immunogen tumor protein p63 Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and -
Add to Cart The item has been addedAMAB91459-100ULMonoclonal Anti-TREM1 antibody produced in mouse (C15-1318-867)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Triggering receptor expressed on myeloid cells 1 Sequence KLTEEKYELKEGQTLDVK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedAMAB90964-100ULMonoclonal Anti-TUFM antibody produced in mouse (C15-1318-612)
Price: $977.14List Price: $1,085.71Monoclonal Anti-TUFM Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Tu -
Add to Cart The item has been addedAMAB90965-100ULMonoclonal Anti-TUFM antibody produced in mouse (C15-1318-613)
Price: $977.14List Price: $1,085.71Monoclonal Anti-TUFM Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Tu -
Add to Cart The item has been addedAMAB90966-100ULMonoclonal Anti-TUFM antibody produced in mouse (C15-1318-614)
Price: $977.14List Price: $1,085.71Monoclonal Anti-TUFM Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Tu -
Add to Cart The item has been addedF6651-100TSTMonoclonal Anti-Tumor Necrosis Factor-alpha-Fluorescein antibody produced in mouse
Price: $708.00List Price: $786.67Specificity The antibody conjugate will identify and quantitate cells containing intracellular forms of human TNF-α. Immunogen recombinant human TNF-α.
