-
Add to Cart The item has been addedAMAB91326-100ULMonoclonal Anti-TYRP1 antibody produced in mouse (C15-1318-789)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to tyrosinase-related protein 1. Sequence VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH Epitope Binds to an epitope located -
Add to Cart The item has been addedAMAB91327-100ULMonoclonal Anti-TYRP1 antibody produced in mouse (C15-1318-790)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to tyrosinase-related protein 1. Sequence VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH Epitope Binds to an epitope located -
Add to Cart The item has been addedAMAB91328-100ULMonoclonal Anti-TYRP1 antibody produced in mouse (C15-1318-791)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to tyrosinase-related protein 1. Sequence VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH Application All Prestige Antibodies -
Add to Cart The item has been addedAMAB91145-100ULMonoclonal Anti-UCHL1 antibody produced in mouse (C15-1318-705)
Price: $977.14List Price: $1,085.71Immunogen ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedAMAB90600-100ULMonoclonal Anti-VANGL1 antibody produced in mouse (C15-1318-473)
Price: $977.14List Price: $1,085.71Immunogen vang-like 1 (van gogh, Drosophila) recombinant protein epitope signature tag (PrEST) Sequence DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY Application All Prestige -
Add to Cart The item has been addedAMAB91043-100ULMonoclonal Anti-VGAT antibody produced in mouse (C15-1318-657)
Price: $977.14List Price: $1,085.71Immunogen solute carrier family 32 member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAMAB91041-100ULMonoclonal Anti-VGLUT1 antibody produced in mouse (C15-1318-655)
Price: $977.14List Price: $1,085.71Vesicular glutamate transporter 1 (VGLUT1), also called as solute carrier family 17 member 7 (SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal -
Add to Cart The item has been addedAMAB91252-100ULMonoclonal Anti-VSIR antibody produced in mouse (C15-1318-749)
Price: $977.14List Price: $1,085.71Immunogen V-set immunoregulatory receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAMAB91253-100ULMonoclonal Anti-VSIR antibody produced in mouse (C15-1318-750)
Price: $977.14List Price: $1,085.71Immunogen V-set immunoregulatory receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedC7706-.2MLMonoclonal Anti-VSV Glycoprotein-Cy3(TM) antibody produced in mouse
Price: $1,026.86List Price: $1,140.95Monoclonal Anti-VSV Glycoprotein (mouse IgG1 isotype) is derived from the P5D4 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from a BALB/c mouse immunized with a synthetic peptide of vesicular stomatitis virus glycoprotein -
Add to Cart The item has been addedAMAB90510-100ULMonoclonal Anti-ZEB1 antibody produced in mouse (C15-1318-436)
Price: $977.14List Price: $1,085.71Immunogen zinc finger E-box binding homeobox 1 recombinant protein epitope signature tag (PrEST) Sequence EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST Application -
Add to Cart The item has been added610-4610Mouse ? Antibody Biotin 1mg (C08-0583-343)
Price: $400.94List Price: $445.49This product is designed for dot blot or western blotting, ELISA, or other detection assays.
