Primary Antibodies

Cell adhesion molecule-related, downregulated by oncogenes (CDON) gene is mapped to human chromosome 11q23–24. The CDO protein encoded by this gene is a known cell surface receptor of the immunoglobulin superfamily This cell surface protein

Immunogen CMT1A duplicated region transcript 15 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen centrosomal protein 131kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Centrosomal protein 152 (CEP152) is a putative mammalian ortholog of Drosophila asterless and is mapped to human chromosome 15q21.1.

Centrosomal protein of 152 kDa (UniProt O94986 also known as Cep152) is encoded by the CEP152 (also known as KIAA0912) gene (Gene ID 22995) in human. The mammalian Asl (Asterless) ortholog Cep152 is a centrosomal protein (CEP) that plays an

Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen centrosomal protein 162kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Centrosomal protein 164 (CEP164) is a centriole appendage protein encoded by the gene mapped to human chromosome 11q23.3.

Immunogen Recombinant protein corresponding to centrosomal protein 164 Sequence EVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the