Primary Antibodies

Immunogen Recombinant protein corresponding to centrosomal protein 170 Sequence KQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

C9orf117 (chromosome 9 open reading frame 117) is shown to be present in the cilia of bronchus and fallopian tube. Immunogen cilia and flagella associated protein 157 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen cilia and flagella associated protein 157 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cilia and flagella associated protein 74 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cilia and flagella associated protein 74 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

C9orf171 (chromosome 9 open reading frame 171) is one of the proteins expressed in ciliated cells in bronchial epithelium. Immunogen cilia and flagella associated protein 77 Application All Prestige Antibodies Powered by Atlas Antibodies are

CXXC finger protein 1 (CFP1) is part of the Setd1A and Setd1B methyltransferase compounds. Research shows that CFP1 also interacts with the cytosine methylation mechanism.

Immunogen CGG triplet repeat binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen CGG triplet repeat binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (EC:2.3.

Immunogen cingulin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.