Primary Antibodies

Immunogen Synthetic peptide directed towards the N terminal of human CHRNG. Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT Physical form Purified antibody supplied in 1x PBS buffer

Immunogen carbohydrate sulfotransferase 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen chondroitin sulfate synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Anti-Ciliated Cell Marker antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma LhS 28 produced by the fusion of mouse myeloma cells (Sp2/0 cells) and splenocytes from BALB/c mice. Specificity Anti-Ciliated Cell Marker

Cytoskeleton-associated protein 5 (CKAP5) is a member of the TOG/XMAP215 family containing heat repeats and plays a role in kinetochore mircotubule protection from depolymerization by MCAK. CKAP5 is the homolog of the Xenopus protein, XMAP25 (also

Immunogen cytoskeleton associated protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cytoskeleton associated protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen C-type lectin domain family 16, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen C-type lectin domain family 16, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen C-type lectin domain family 16, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CDC-like kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.