-
Add to Cart The item has been addedHPA036104-100ULAnti-COL18A1 antibody produced in rabbit (C15-1454-172)
Price: $928.29List Price: $1,031.43Immunogen collagen, type XVIII, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA008405-100ULAnti-COL1A1 antibody produced in rabbit (C15-1447-128)
Price: $977.14List Price: $1,085.71Immunogen Collagen alpha-1(I) chain precursor recombinant protein epitope signature tag (PrEST) Sequence NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK Application All Prestige Antibodies -
Add to Cart The item has been addedHPA011795-100ULAnti-COL1A1 antibody produced in rabbit (C15-1447-646)
Price: $977.14List Price: $1,085.71Collagen type I alpha 1 chain (COL1A1) gene is located on the human chromosome at 17q21.33. -
Add to Cart The item has been addedHPA012111-100ULANTI-COL1A1 ANTIBODY PRODUCED IN RABBIT (C15-1447-735)
Price: $977.14List Price: $1,085.71Immunogen collagen type I alpha 1 chain Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA007583-100ULAnti-COL3A1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Collagen α-1(III) chain precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA030769-100ULAnti-COL5A1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen collagen, type V, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA019142-100ULAnti-COL6A1 antibody produced in rabbit (C15-1449-233)
Price: $879.43List Price: $977.14Immunogen Collagen alpha-1(VI) chain precursor recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies ® are highly characterized and extensively validated antibodies with the added benefit of all available -
Add to Cart The item has been addedHPA029401-100ULAnti-COL6A1 antibody produced in rabbit (C15-1452-248)
Price: $879.43List Price: $977.14Immunogen collagen, type VI, alpha 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAB7821Anti-Collagen Type VI Antibody (C15-1316-444)
Price: $804.00List Price: $893.33Specificity Human collagen type I <0.5% Human collagen type II <0. -
Add to Cart The item has been addedC6987-200ULAnti-Cortactin (GK-18) antibody produced in rabbit
Price: $999.43List Price: $1,110.48Cortactin gene is located on human chromosome 11q13. Cortactin exists as multiple isoforms (75-85 kDa), formed by alternative splicing. -
Add to Cart The item has been addedABC242Anti-CRKL Antibody (C15-1316-683)
Price: $804.00List Price: $893.33Crk-like protein (CRKL) is a 39 kDa adaptor protein with one SH2 and two SH3 binding domains. CRKL is the major protein which is tyrosine phosphorylated in response to BCR/ABL (chronic myelogenous leukemia) and growth factor activation. -
Add to Cart The item has been addedHPA000532-100ULAnti-CRKL antibody produced in rabbit (C15-1444-969)
Price: $879.43List Price: $977.14Immunogen v-crk avian sarcoma virus CT10 oncogene homolog-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
