Primary Antibodies

CYSLTR1 (cysteinyl leukotriene receptor 1) is a GPCR (G-protein couple receptor), which functions as a receptor for CysLTs, such as, LTC4 (leukotriene C4), LTD4, and LTE4. This receptor is expressed by epithelial cells, and translocates to nucleus

Immunogen cysteine-rich tail protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cysteine-rich tail protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Cystatin-C is a cysteine protease inhibitor in mammals, which is essential in protein degradation and keeping an equilibrium between inhibitors and proteases. It is thought to be a better marker for renal dysfunction and potential kidney injury

Specificity Crim1 SUBCELLULAR LOCALIZATION: Intracellular and Membrane associated. Immunogen Recombinant protein from the cytoplasmic tail of mouse Crim1.

Immunogen cysteine-rich transmembrane module containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Mitochondrially encoded cytochrome b (MT-CYB CYTB) is encoded by mitochondrial DNA. Immunogen Synthetic peptide directed towards the N terminal region of human CYTB Application Anti-CYTB antibody produced in rabbit is suitable for western blotting

Immunogen Recombinant protein corresponding to cytokine like 1 Sequence TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Specificity This antibody reacts with the suprabasal cells of stratified squamous epithelia in human, murine and porcine species. Immunogen Keratin 1 and 10.

Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues.

Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues.

Specificity The antibody is specific to human cytokeratin 19 and is reactive with cells of epithelial origin. Cytokeratin 19 is the smallest human cytokeratin (40 kDa) and is found in many simple and invariably in some non-keratinising stratified