Primary Antibodies

Immunogen DEAD (Asp-Glu-Ala-Asp) box helicase 17 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The protein Death-associated protein 1 or also known as DAP-1/DAP1 and encoded by the gene DAP/DAP1 is a negative regulator of autophagy. The link of DAP1 to autophagy was recognized because in DAP1 knockdowns there was enhanced autophagic flux and

Anti-dEGF Receptor, Extracellular Domain antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma C-273 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with a recombinant

Immunogen diacylglycerol kinase, delta 130kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen diacylglycerol kinase, delta 130kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen diacylglycerol kinase, zeta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The protein DGL-alpha is a lipase enzyme that catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG) endocannabinoid in tissues. Endocannabinoids are a group of lipid-like molecules that are neuromodulatory in nature and

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. The histones have an amino terminal tail, a globular domain, and a carboxy-terminal tail.

Disrupted in schizophrenia 1 (DISC1) is a candidate gene for susceptibility to schizophrenia. It was discovered through chromosomal analysis of a large Scottish family whose members exhibited schizophrenia and related psychiatric disorders.

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Immunogen Recombinant protein corresponding to disrupted in schizophrenia 1 Sequence LQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIET Application All Prestige Antibodies Powered by