Primary Antibodies

Immunogen chromosome 16 open reading frame 48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen enolase superfamily member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Ectonucleoside triphosphate diphosphohydrolase 1 recombinant protein epitope signature tag (PrEST) Application Anti-ENTPD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Specificity CBL419 is specific for eosinophil major basic protein irrespective of the stages of eosinophil activation and can be regarded as a pan-eosinophil" marker. This antibody will recognize the 23."

Eps15, also known as Epidermal growth factor receptor substrate 15, Protein AF-1p, and encoded by the gene EPS15/AF1P, is an important protein involved in cell growth regulation, cell spreading, proliferation, invagination and budding. Epidermal

Epidermal growth factor receptor substrate 15 (EPS15) localizes to the clathrin-coated pits at the plasma membrane. It contains three N-terminal EPS15 homology (EH) domains, an intermediate coiled-coil domain and a binding domain at the C-terminal

Immunogen Recombinant protein corresponding to epidermal growth factor receptor pathway substrate 15 Sequence DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL Application All Prestige Antibodies Powered by Atlas

The gene EPS15L1 (epidermal growth factor receptor substrate 15-like 1) is mapped to human chromosome 19p13.11.

Immunogen epidermal growth factor receptor pathway substrate 15-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

EPSTI1 (epithelial stromal interaction 1) is a putative 307 amino acid stromal fibroblast-induced protein located to chromosome 13q13.3.

Extracellular signal-regulated kinase 5 (ERK5), also referred to as big-MAP kinase 1 (BMK1), is a protein that belongs to mitogen-activated protein kinases family and is expressed mainly in skeletal muscle, kidney, heart and placenta. ERK5 contains

Extradenticle (EXD) is a Drosophila transcription factor that regulates brain and eye development. It modulates the transcription network in the dorsal retinal rim and the FGF/branchless expression in mesodermal bridge cells.