Primary Antibodies

Immunogen FIC domain containing Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen fidgetin-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Filamin, also known as actin-binding protein, is a large flexible V-shaped actin cross-linking cytoplasmic protein present in vertebrates of both muscle and non-muscle cells. It has actin-binding domains at the ends of each arm.

Immunogen FIP1 like 1 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen factor interacting with PAPOLA and CPSF1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen FK506-binding protein 14 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene FK506 binding protein 14 (FKBP14) is mapped to human chromosome 7p15.1.

Immunogen FK506-binding protein 15 recombinant protein epitope signature tag (PrEST) Application Anti-FKBP15 antibody produced in rabbit has been used for co-immunoprecipitation. Anti-FKBP15 antibody produced in rabbit, a Prestige Antibody, is

Immunogen Synthetic peptide directed towards the N terminal region of human FLJ14213 Sequence Synthetic peptide located within the following region: SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ Physical form Purified antibody supplied in 1x

Immunogen formation of mitochondrial complex V assembly factor 1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen formation of mitochondrial complex V assembly factor 1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen fructosamine 3 kinase related protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive