-
Add to Cart The item has been addedHPA075325-100ULANTI-GALNT16 ANTIBODY PRODUCED IN RABBIT (C15-1466-714)
Price: $977.14List Price: $1,085.71Immunogen polypeptide N-acetylgalactosaminyltransferase 16 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedABE421Anti-GATA-like protein 1 Antibody (C15-1317-152)
Price: $804.00List Price: $893.33GATA-like protein 1 (GLP-1) is also known as GATA-type zinc finger protein 1. GATA-like protein 1 is a zinc finger protein that functions as a transcriptional repressor. -
Add to Cart The item has been addedABE1934Anti-Gcn5 Antibody (C15-1316-992)
Price: $756.00List Price: $840.00Histone acetyltransferase KAT2A (EC 2.3. -
Add to Cart The item has been addedG1544-100UGAnti-GFP, N-terminal antibody produced in rabbit
Price: $853.71List Price: $948.57Green fluorescent protein (GFP) chromophore contains hexapeptide fragment with Phe64-Ser-Tyr-Gly-Val-Gln69 aminoacid sequence. GFP structure contains a 11-stranded β-barrel and a central helix and corresponds to a molecular weight of -
Add to Cart The item has been addedHPA044348-100ULAnti-GID4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 17 open reading frame 39 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA044887-100ULAnti-GIMAP1 antibody produced in rabbit (C15-1458-323)
Price: $928.29List Price: $1,031.43Immunogen GTPase, IMAP family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA053441-100ULAnti-GIMAP1 antibody produced in rabbit (C15-1461-338)
Price: $928.29List Price: $1,031.43Immunogen GTPase, IMAP family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA019135-100ULAnti-GIMAP4 antibody produced in rabbit (C15-1449-228)
Price: $879.43List Price: $977.14The gene GIMAP4 (GTPase IMAP family member 4) is mapped to human chromosome 7q36. It belongs to GIMAP family of proteins. -
Add to Cart The item has been addedHPA019137-100ULAnti-GIMAP4 antibody produced in rabbit (C15-1449-230)
Price: $879.43List Price: $977.14The gene GIMAP4 (GTPase IMAP family member 4) is mapped to human chromosome 7q36. It belongs to GIMAP family of proteins. -
Add to Cart The item has been addedHPA027198-100ULAnti-GIMAP4 antibody produced in rabbit (C15-1451-361)
Price: $879.43List Price: $977.14Immunogen GTPase, IMAP family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA026715-100ULAnti-GIMAP6 antibody produced in rabbit (C15-1451-170)
Price: $879.43List Price: $977.14Immunogen GTPase IMAP family member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA050740-100ULAnti-GIMAP6 antibody produced in rabbit (C15-1460-398)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to GTPase, IMAP family member 6. Sequence SLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQK Application All Prestige Antibodies Powered by Atlas
