Primary Antibodies

Immunogen Recombinant protein corresponding to immunoglobulin superfamily member 1 Sequence SRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQM Application

Immunogen immunoglobulin superfamily, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen immunoglobulin superfamily, member 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen immunoglobulin superfamily, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen immunoglobulin superfamily, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen IKBKB interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen IKBKB interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen IKBKB interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen NF-kappa-B essential modulator recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Interleukin-1 receptor accessory protein (IL-1RAcP), also known as Interleukin-1 receptor 3 (IL-1R-3, IL-1R3) forms a complex with IL-1RI in response to IL-1 treatment. The IL-1 receptor-associated kinase (IRAK), which mediates activation of NF-kB

Interleukin-34 (IL-34) was identified through a functional screening of a library of secreted proteins after transfection of an embryonic kidney cell line with recombinant cDNAs. Flow cytometry and monocyte viability assays demonstrated increased

Interleukin 11 receptor subunit alpha (IL11RA) gene has 13 exons. The protein has an extracellular, transmembrane and a cytoplasmic domain.