Primary Antibodies

Immunogen KRIT1, ankyrin repeat containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen KRR1, small subunit (SSU) processome component, homolog (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen KRR1, small subunit (SSU) processome component, homolog (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Keratin 1, type II (KRT1) is a protein of the cytoplasmic intermediate filament expressed in keratinocytes. KRT1 has an amino-terminal domain, a non-helical carboxy terminal domain and two rod domains.

Immunogen keratin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen keratin 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to keratin 13 Sequence EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Synthetic peptide directed towards the C terminal region of human KRT14 Application Anti-KRT14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 &#956g/ml.

CK14/ KRT14 (keratin 14) is one of the cytokeratin isotypes of human cells. It is an intermediate filament protein.

The gene KRT15 (keratin 15) is mapped to human chromosome 17q21. It is an acidic intermediate filament protein.

Immunogen Keratin, type I cytoskeletal 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the C terminal region of human KRT17 Biochem/physiol Actions KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal