Primary Antibodies

Immunogen megakaryocyte-associated tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the C terminal region of human MBD1 Biochem/physiol Actions MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with

Immunogen Recombinant protein corresponding to methyl-CpG binding domain protein 1 Sequence PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

C19orf59 is also called MCEMP1 (mast cell-expressed membrane protein 1) is a single pass transmembrane protein. It is composed of 186 amino acids, and is predominantly expressed in mast cells and monocytes.

Specificity Recognizes Human Mcl-1. Not reactive with other members of the Bcl-2 family, as verified by immunoblot.

Immunogen myeloid cell leukemia 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen minichromosome maintenance complex binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

The protein named Microcephalin and encoded by the human gene named MCPH1 is a DNA/chromatin binding protein implicated in chromosome condensation and DNA damage induced cellular responses. MCPH1 plays a role in neurogenesis and is involved in the

The gene MCTP1 (multiple C2 and transmembrane domain-containing protein 1) is mapped to human chromosome 5q15. It belongs to MCTP family of conserved C 2 domain proteins.

ME1 (malic enzyme 1) exists as a homotetaramer, where its two dimers are linked to each other. It is one of the three isoforms of ME enzyme, which are classified according to their sub-cellular localization and cofactor specificity.

Immunogen male-enhanced antigen 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene MED15 (mediator complex subunit 15) is mapped to human chromosome 22q11.2, a region found to be deleted in DiGeorge syndrome.