Primary Antibody Conjugates

Immunogen Synthetic peptide directed towards the C terminal region of human C3orf59 Sequence Synthetic peptide located within the following region: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF Physical form Supplied at 0.5 mg/ml in

General description Prominin is a novel plasma membrane protein with an N-terminal extracellular domain, five transmembrane segments flanking two short cytoplasmic loops and two large glycosylated extracellular domains, and a cytoplasmic

Specificity This antibody recognizes the 90 kDa single chain membrane glycoprotein (GPIIIb) that is found on monocytes/macrophages and platelets. FUSION PARTNER: NS1 myeloma cell line Immunogen Human tonsil cells and peripheral blood mononuclear

General description BIOCHEMISTRY: p I = 6.1 Specificity This antibody binds to a 17-25kD glycoprotein (Fletcher et al.

General description CD73, also known as Ecto-5&#8242:-nucleotidase, catalyzes the conversion of purine 5&#8242: mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound

Immunogen Synthetic peptide directed towards the C-terminal region of Human CEMP1 Sequence Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the C-terminal region of Human CEMP1 Sequence Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the C-terminal region of Human CEMP1 Sequence Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI Physical form Supplied at 0.5 mg/ml in

General description The protein encoded by this gene belongs to the CDC2-like protein kinase (CLK) family. This protein kinase can interact with and phosphorylate the serine- and arginine-rich (SR) proteins, which are known to play an important

General description The protein encoded by this gene belongs to the CDC2-like protein kinase (CLK) family. This protein kinase can interact with and phosphorylate the serine- and arginine-rich (SR) proteins, which are known to play an important

General description The protein encoded by this gene belongs to the CDC2-like protein kinase (CLK) family. This protein kinase can interact with and phosphorylate the serine- and arginine-rich (SR) proteins, which are known to play an important

General description CLUH is involved in proper cytoplasmic distribution of mitochondria. Immunogen Synthetic peptide directed towards the N-terminal region of Human CLUH Sequence Synthetic peptide located within the following region: