Primary Antibody Conjugates

Specificity Based on immunoelectrophoresis, the antibody reacts with the heavy chains on rabbit IgG but not with the light chains on most rabbit immunoglobulins. No antibody was detected against rabbit IgM, or against immunoglobulin serum proteins,

Immunoglobulin G (IgG), is one of the most abundant proteins in human serum with normal levels between 8-17 mg/mL in adult blood. IgG is important for our defence against microorganisms and the molecules are produced by B lymphocytes as a part of

Immunoglobulin G (IgG), is one of the most abundant proteins in human serum with normal levels between 8-17 mg/mL in adult blood. IgG is important for our defence against microorganisms and the molecules are produced by B lymphocytes as a part of

Integrin beta 1, also known as CD29, is a 130 kDa transmembrane glycoprotein that forms noncovalent complexes with various Integrin alpha subunits (including alpha 1, alpha 2, alpha 3, alpha 4, alpha 5, and alpha 6, also known as CD49a, CD49b,

Ki67 antigen is the prototypic cell cycle related nuclear protein, expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M phase). It is absent in resting (G0) cells.

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called MAPK1 and MAPK2, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are

Cathepsins are lysosomal proteases that play an important role in the intracellular degradation of exogenous and endogenous proteins, in activation of enzyme precursors, and in tumor invasion and metastasis. They are normally localized in lysosomes

Immunogen cytochrome c oxidase subunit IV isoform 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cytochrome c oxidase subunit IV isoform 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cytochrome c oxidase subunit IV isoform 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to cut-like homeobox 1 Sequence LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS Epitope Binds to an epitope located within the peptide sequence

Immunogen Recombinant protein corresponding to cut-like homeobox 1 Sequence LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS Epitope Binds to an epitope located within the peptide sequence