-
Add to Cart The item has been addedHPA053341-100ULImmunogen Recombinant protein corresponding to KIAA0408 Sequence DWRPSNLSGRPRSADPRSNYGVVEKLLKTYETATESALQNSKCFQDNWTKCNSDVSGGATLSQHLEMLQMEQQFQQKTAVWGGQEVKQGI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedSAB2104595-100ULImmunogen Synthetic peptide directed towards the N terminal region of human KIAA0427 Sequence Synthetic peptide located within the following region: SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL Physical form Purified antibody supplied -
Add to Cart The item has been addedHPA017992-100ULThe gene KIAA0430 is also referred as LKAP (Limkain-b1). LKAP is suggested to be an RNA-binding protein. -
Add to Cart The item has been addedHPA035089-100ULImmunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA035090-100ULImmunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA023057-100ULKIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA023494-100ULKIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA021036-100ULSigma Aldrich
ANTI-KIAA0895 ANTIBODY PRODUCED IN RABBIT (C15-1449-734)
Price: $959.88List Price: $1,066.53Immunogen KIAA0895 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA061066-100ULImmunogen KIAA0895 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA065996-100ULImmunogen KIAA0895-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA008796-100ULKIAA0907, also known as bring lots of money (BLOM)7 is a KH-domain containing protein. It is a component of the spliceosome, and also acts as a SNEV Prp19-Pso4 -interacting partner. -
Add to Cart The item has been addedHPA043472-100ULSigma Aldrich
ANTI-KIAA0922 ANTIBODY PRODUCED IN RABBIT (C15-1457-702)
Price: $1,013.20List Price: $1,125.78Immunogen KIAA0922 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
