Protein L Products

Immunogen leiomodin 2 (cardiac) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen leiomodin 3 (fetal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

LMTK2 (lemur tyrosine kinase 2) contains two transmembrane domains at its N-terminus, a kinase domain and a very long C-terminal tail domain with serine/threonine/tyrosine kinase activity. The gene is mapped to human chromosome 7q21.

Immunogen lemur tyrosine kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

LMX-1 is a transcription factor that belongs to the LIM-homeodomain (LIM-HD) transcription factor family. It is induced within the ventral midbrain as a response to early signaling.

Immunogen LIM homeobox transcription factor 1, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene KIAA1715 is also referred to as LNP1 (Lunapark1) and encodes a member of the conserved lunapark protein family. The protein is characterized by two transmembrane domains and a zinc finger motif.

LNX1 (ligand of numb-protein X 1) is the PDZ (PSD95, Dlg1, and zo-1) domain-containing member of the RING (really interesting new gene) finger-type E3 ubiquitin ligase family. It participates in tumorigenesis.

Immunogen ligand of numb-protein X 1, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ligand of numb-protein X 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to lysophosphatidic acid receptor 4 Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen lysophosphatidic acid receptor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in