Protein L Products

Immunogen La ribonucleoprotein domain family, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

La ribonucleoprotein domain family member 4B (LARP4B) is encoded by the gene mapped to human chromosome 10p15.3.

Immunogen La ribonucleoprotein domain family, member 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen LARP6 (NP_060827, 1 a.a.

Immunogen Synthetic peptide directed towards the C terminal region of human LARP7 Sequence Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL Physical form Purified antibody supplied in 1x PBS

La ribonucleoprotein domain family member 7 (LARP7), also known as HDCMA18P or PIP7S, is the member of LARP RNA-binding protein family. The gene coding for this oligopyrimidine-binding protein is mapped near human chromosome 4q25.

Immunogen La ribonucleoprotein domain family, member 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

LAT (linker for activation of T cells) is a leukocyte type III transmembrane adaptor protein. It is made of 262 amino acids, and has a shorter isoform made of 233 amino acids.

Linker for activation of T-cells family member 2 is a protein encoded by the LAT2 gene in humans. It is a transmembrane adaptor protein and is expressed in various myeloid and lymphoid cells.

The gene LATS1 (large tumor suppressor kinase 1) is mapped to human chromosome 6q25.1.

Immunogen LATS, large tumor suppressor, homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen large tumor suppressor kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in