Protein L Products

The gene DLEC1 (deleted in lung and esophageal cancer protein 1) is mapped to human chromosome 3p21.3.

DLL4 is a membrane-bound Notch ligand that belongs to the &#948 protein family. Apart from the membrane-bound region, DLL4 consists of extracellular EGF-like domains and a receptor-binding DSL domain.

Immunogen denticleless homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen elaC homolog 1 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen elaC ribonuclease Z 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen ELAV like RNA binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to ELAV like RNA binding protein 4 Sequence VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen elongation factor RNA polymerase II recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Elongation factor for RNA polymerase II 3 (ELL3) is specific for testis and belongs to eleven nineteen lysine-rich leukemia (ELL) protein family. It encodes a 50 kDa protein, with a catalytic domain in N-terminus.