-
HPA039378-100UL
Sigma-Aldrich
Anti-LRRC28 antibody produced in rabbit (C15-1455-702)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040784-100UL
Sigma-Aldrich
Anti-LRRC28 antibody produced in rabbit (C15-1456-358)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA066130-100UL
Sigma-Aldrich
Anti-LRRC28 antibody produced in rabbit (C15-1465-026)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 28 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA034998-100ULImmunogen leucine rich repeat containing 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA017975-100ULThe gene encoding leucine rich repeat containing 3 (LRRC3) is localized on human chromosome 21. Immunogen Leucine-rich repeat-containing protein 3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies
-
HPA055775-100UL
Sigma-Aldrich
Anti-LRRC32 antibody produced in rabbit (C15-1462-120)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to leucine rich repeat containing 32 Sequence NLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA058434-100UL
Sigma-Aldrich
Anti-LRRC32 antibody produced in rabbit (C15-1462-948)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to leucine rich repeat containing 32 Sequence GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA035747-100ULImmunogen leucine rich repeat containing 34 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA055237-100UL
Sigma-Aldrich
Anti-LRRC36 antibody produced in rabbit (C15-1461-944)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 36 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA058479-100UL
Sigma-Aldrich
Anti-LRRC36 antibody produced in rabbit (C15-1462-959)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 36 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA042121-100UL
Sigma-Aldrich
Anti-LRRC37A antibody produced in rabbit (C15-1457-073)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 37A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA043056-100UL
Sigma-Aldrich
Anti-LRRC37A antibody produced in rabbit (C15-1457-501)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 37A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization