-
Add to Cart The item has been addedHPA024768-100ULSigma-Aldrich
Anti-LRRC45 antibody produced in rabbit (C15-1450-881)
Price: $879.43List Price: $977.14The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and -
Add to Cart The item has been addedHPA021882-100ULLRRC46 (leucine rich repeat containing 46) is classified as a differentially expressed gene-probes (DEGs). Its higher expressions have been observed in estrogen receptor positive breast cancer tumors. -
Add to Cart The item has been addedHPA008512-100ULSigma-Aldrich
Anti-LRRC47 antibody produced in rabbit (C15-1447-158)
Price: $879.43List Price: $977.14Immunogen Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST) Sequence PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK Application -
Add to Cart The item has been addedHPA012018-100ULSigma-Aldrich
Anti-LRRC47 antibody produced in rabbit (C15-1447-710)
Price: $879.43List Price: $977.14Immunogen Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA015596-100ULImmunogen leucine rich repeat containing 49 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA058986-100ULImmunogen leucine rich repeat containing 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA054800-100ULSigma-Aldrich
Anti-LRRC4C antibody produced in rabbit (C15-1461-793)
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat containing 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA075816-100ULSigma-Aldrich
ANTI-LRRC4C ANTIBODY PRODUCED IN RABBIT (C15-1466-779)
Price: $977.14List Price: $1,085.71Immunogen leucine rich repeat containing 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA054062-100ULImmunogen leucine rich repeat containing 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA014053-100ULThe gene LRRC55 (leucine rich repeat containing 55) encodes a LRRC26 paralogous protein that belongs to the γ family of the BK (voltage and calcium-activated potassium) channel auxiliary proteins. It is specifically expressed in the brain. -
Add to Cart The item has been addedHPA038728-100ULImmunogen leucine rich repeat containing 56 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA040894-100ULImmunogen leucine rich repeat containing 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
