Protein L Products

Immunogen LRFN1 (XP_290842, 1 a.a.

Immunogen leucine rich repeat and fibronectin type III domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Leucine-rich repeat and fibronectin type-III domain-containing protein 5 precursor recombinant protein epitope signature tag (PrEST) Application Anti-LRFN5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by

General description The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte

Cadherin 17 also known as Liver Intestine cadherin (LI cadherin) is cell adhesion protein commonly over expressed in liver, pancreatic and gastric cancer Immunogen Leucine-rich &#945-2-glycoprotein precursor recombinant protein epitope signature

Leucine-rich &#945-2-glycoprotein 1 (LRG1) was first identified as a trace protein in human serum and it belongs to the leucine-rich repeat (LRR) family. It is involved with various biological processes such as protein-protein interactions, cell

Immunogen leucine-rich repeats and immunoglobulin-like domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Leucine-rich repeats and immunoglobulin-like domains protein 2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen LRIT3 (AAI04038.1, 1 a.

Immunogen Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Synthetic peptide directed towards the middle region of human LRP1 Sequence Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR Physical form Purified antibody supplied in 1x PBS