Protein L Products

LRP12 (low density lipoprotein receptor-related protein 12) is a novel putative transmembrane receptor protein located on human chromosome 8, band q22.2-23.

Immunogen low density lipoprotein receptor-related protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to low density lipoprotein receptor-related protein 1B. Sequence IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF Application All Prestige Antibodies Powered by Atlas

Immunogen low density lipoprotein receptor-related protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Low-density lipoprotein receptor-related protein 2 precursor recombinant protein epitope signature tag (PrEST) Application Anti-LRP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas

Immunogen LRP2 binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen LRP2 binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

General description Low density lipoprotein (LDL) receptor-related protein (LRP), a member of the LDL receptor family, binds multiple classes of ligands and has been implicated in a broad range of normal and disease processes involving lipid

Immunogen LDL receptor related protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

General description Anti-LRP3 Antibody detects endogenous levels of total LRP3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human LRP3.

Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)