-
HPA079339-100ULImmunogen myeloid leukemia factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA052707-100UL
Sigma-Aldrich
Anti-MLH1 antibody produced in rabbit (C15-1461-113)
Price: $928.29List Price: $1,031.43Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA060714-100UL
Sigma-Aldrich
Anti-MLH1 antibody produced in rabbit (C15-1463-608)
Price: $928.29List Price: $1,031.43Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA060570-100ULImmunogen mutL homolog 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA029252-100ULImmunogen Recombinant protein corresponding to muscular LMNA interacting protein Sequence SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the
-
HPA078638-100ULImmunogen mixed lineage kinase domain like pseudokinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
ABE1867Histone-lysine N-methyltransferase 2D (EC 2.1.
-
AV33704-100ULMyeloid/lymphoid or mixed-lineage leukemia 4 (MLL4) is a histone-lysine N-methyltransferase widely expressed in the nucleus of multiple cell types. It contains a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET domain.
-
HPA031166-100ULImmunogen myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) translocated to, 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
-
HPA005747-100ULImmunogen Protein AF-10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
HPA000540-100ULImmunogen myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) translocated to, 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
-
AV38489-100ULImmunogen Synthetic peptide directed towards the N terminal region of human MLLT3 Biochem/physiol Actions MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces