Protein L Products

Immunogen MLF1 (NP_071888.1, 1 a.

Immunogen myeloid leukemia factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to muscular LMNA interacting protein Sequence SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen mixed lineage kinase domain like pseudokinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL family, including MLL3. The MLL SET domain is a histone H3 Lys4 (K4)-specific methyltransferase whose activity is stimulated with acetylated

General description The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL family, including MLL3. The MLL SET domain is a histone H3 Lys4 (K4)-specific methyltransferase whose activity is stimulated with acetylated

General description The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL family, including MLL3. The MLL SET domain is a histone H3 Lys4 (K4)-specific methyltransferase whose activity is stimulated with acetylated