-
HPA053341-100UL
Anti-KIAA0408 antibody produced in rabbit (C15-1461-308)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to KIAA0408 Sequence DWRPSNLSGRPRSADPRSNYGVVEKLLKTYETATESALQNSKCFQDNWTKCNSDVSGGATLSQHLEMLQMEQQFQQKTAVWGGQEVKQGI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA017992-100UL
Anti-KIAA0430 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene KIAA0430 is also referred as LKAP (Limkain-b1). LKAP is suggested to be an RNA-binding protein. -
HPA035089-100UL
Anti-KIAA0556 antibody produced in rabbit (C15-1453-686)
Price: $928.29List Price: $1,031.43Immunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA035090-100UL
Anti-KIAA0556 antibody produced in rabbit (C15-1453-687)
Price: $928.29List Price: $1,031.43Immunogen KIAA0556 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA023057-100UL
Anti-KIAA0753 antibody produced in rabbit (C15-1450-235)
Price: $879.43List Price: $977.14KIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA023494-100UL
Anti-KIAA0753 antibody produced in rabbit (C15-1450-419)
Price: $879.43List Price: $977.14KIAA0753 localizes to the centriolar satellite and the gene is mapped to human chromosome 17p13. Immunogen Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA021036-100UL
Anti-KIAA0895 antibody produced in rabbit (C15-1449-734)
Price: $879.43List Price: $977.14Immunogen KIAA0895 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA061066-100UL
Anti-KIAA0895 antibody produced in rabbit (C15-1463-691)
Price: $928.29List Price: $1,031.43Immunogen KIAA0895 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA065996-100UL
Anti-KIAA0895L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen KIAA0895-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA008796-100UL
Anti-KIAA0907 antibody produced in rabbit
Price: $879.43List Price: $977.14KIAA0907, also known as bring lots of money (BLOM)7 is a KH-domain containing protein. It is a component of the spliceosome, and also acts as a SNEV Prp19-Pso4 -interacting partner. -
HPA043472-100UL
Anti-KIAA0922 antibody produced in rabbit (C15-1457-702)
Price: $928.29List Price: $1,031.43Immunogen KIAA0922 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA048443-100UL
Anti-KIAA0922 antibody produced in rabbit (C15-1459-578)
Price: $928.29List Price: $1,031.43Immunogen KIAA0922 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most