Protein L Products

Immunogen ELAV like RNA binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to ELAV like RNA binding protein 4 Sequence VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen elongation factor RNA polymerase II recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Elongation factor for RNA polymerase II 3 (ELL3) is specific for testis and belongs to eleven nineteen lysine-rich leukemia (ELL) protein family. It encodes a 50 kDa protein, with a catalytic domain in N-terminus.

Immunogen elongation factor for RNA polymerase II 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen elastin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Elastin (ELN) is a non-soluble protein. The highly durable protein is a major component of the extracellular matrix and is an intrinsic indicator of pathologic states.

Immunogen elongin B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen ELOVL fatty acid elongase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Specificity The antibody detects endogenous levels of total ELOVL1 protein. Immunogen Synthesized peptide derived from internal of human ELOVL1.

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.