-
HPA005830-100ULThe gene L1CAM (L1 cell adhesion molecule) encodes a member of the immunoglobulin supergene family. The encoded protein contains a cytoplasmic intracellular domain, one single-pass transmembrane region and an extracellular domain containing six
-
HPA068051-100ULImmunogen Recombinant protein corresponding to l(3)mbt-like 1 (Drosophila) Sequence STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed
-
HPA044382-100UL
Sigma-Aldrich
Anti-L3MBTL3 antibody produced in rabbit (C15-1458-126)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA053035-100UL
Sigma-Aldrich
Anti-L3MBTL3 antibody produced in rabbit (C15-1461-212)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 3 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA064194-100UL
Sigma-Aldrich
Anti-L3MBTL4 antibody produced in rabbit (C15-1464-578)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 4 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA069042-100UL
Sigma-Aldrich
Anti-L3MBTL4 antibody produced in rabbit (C15-1465-592)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 4 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036122-100UL
Sigma-Aldrich
Anti-LAGE3 antibody produced in rabbit (C15-1454-180)
Price: $928.29List Price: $1,031.43Immunogen L antigen family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036123-100UL
Sigma-Aldrich
Anti-LAGE3 antibody produced in rabbit (C15-1454-181)
Price: $928.29List Price: $1,031.43Immunogen L antigen family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029855-100UL
Sigma-Aldrich
Anti-LALBA antibody produced in rabbit (C15-1452-435)
Price: $879.43List Price: $977.14Immunogen lactalbumin, alpha- Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA029856-100UL
Sigma-Aldrich
Anti-LALBA antibody produced in rabbit (C15-1452-436)
Price: $879.43List Price: $977.14The gene LALBA (α-lactalbumin) is mapped to human chromosome 12q13. It is a small acidic calcium-binding milk protein. -
HPA029606-100UL
Sigma-Aldrich
Anti-LAP3 antibody produced in rabbit (C15-1452-336)
Price: $879.43List Price: $977.14Immunogen leucine aminopeptidase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA029607-100UL
Sigma-Aldrich
Anti-LAP3 antibody produced in rabbit (C15-1452-337)
Price: $879.43List Price: $977.14Immunogen leucine aminopeptidase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported