Secondary Antibodies

Immunogen microtubule associated monoxygenase, calponin and LIM domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

The gene MICALL2 (MICAL like 2) is mapped to human chromosome 7p22.3.

The microtubule-associated protein 2 (MAP2) is an abundant neuronal cytoskeletal protein that binds to tubulin and stabilizes microtubules. (Herzog and Weber, 1978).

MICU2 (mitochondrial calcium uptake 2) belongs to the uniporter complex. It is vigorously expressed in visceral organs.

Immunogen MINDY lysine 48 deubiquitinase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen MINDY lysine 48 deubiquitinase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen MIS12, MIND kinetochore complex component, homolog (S. pombe) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Mitofusin-2 (Mfn2) is a membrane protein of the mitochondria and is important in mitochondrial fusion in mammalian cells. Mfn2 activity has also been implicated in mitochondrial metabolism and the loss of Mfn2 may be the reason for certain

MKNK2 (MAP kinase interacting serine/threonine kinase 2) is a serine threonine kinase belonging to the human MAP kinase-interacting kinases group. It consists of a zinc-binding domain and an atypical open conformation region.

Immunogen Recombinant protein corresponding to MAP kinase interacting serine/threonine kinase 2 Sequence AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Makorin-2 (MKRN2) is a novel ubiquitin E3 ligase that is also known as HSPC070. It is a member of the MKRN gene family.

Makorin ring finger protein 2 (MKRN2) belongs to makorin RING (Really Interesting New Gene) zinc-finger family and is a 42 kDa ribonucleoprotein. It has zinc finger motifs in N and C-terminus.