Secondary Antibodies

Immunogen ankyrin repeat domain 62 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Annexin A1 (ANXA1) is a calcium and phospholipid binding protein almost entirely restricted to microglia in the CNS. During the peripheral inflammatory response, Annexin A1 is instrumental in the phagocytosis of apoptotic leukocytes.

Annexin A2 is known by several other names including: Annexin II, Calpactin I heavy chain, Chromobindin-8, Lipocortin II and Placental anticoagulant protein IV. Annexin A2 is a calcium-regulated membrane-binding protein that binds two calcium ions

Annexin A3 is also called 35-alpha calcimedin, Annexin III, Annexin-3, Inositol 1,2-cyclic phosphate 2-phosphohydrolase, Lipocortin III and Placental anticoagulant protein III (PAP-III). Annexin A3 is an inhibitor of phospholipase A2 that has

Immunogen Junctophilin-4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen adaptor-related protein complex 1, mu 2 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen adaptor-related protein complex 1, sigma 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Synthetic peptide directed towards the C terminal region of human AP2B1 Biochem/physiol Actions AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles.

Immunogen adaptor-related protein complex 2, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to adaptor related protein complex 2 beta 1 subunit Sequence PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

The gene AP2M1 (adaptor related protein complex 2 &#956 1 subunit) is mapped to human chromosome 3q27.1.

Immunogen adaptor-related protein complex 2, mu 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive