Secondary Antibodies

Immunogen nitrogen permease regulator-like 2 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen nitrogen permease regulator-like 2 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen neuronal pentraxin II Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to neuronal pentraxin 2 Sequence ELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

NR2C2 (nuclear receptor subfamily 2, group C, member 2) is a protein encoded by the NR2C2 gene in humans and is mapped to chromosome to 3p25. It is a novel member of the nuclear hormone receptor family.

NR2F2 codes for a steroid hormone receptor that is involved in the differentiation of human stem cells and trophoblasts. Genetic variations in NR2F2 are associated with congenital cardiac disorders.

Immunogen Synthetic peptide directed towards the N terminal region of human NR2F6 Sequence Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human NR4A2 Biochem/physiol Actions NR4A2 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. The protein may act as a transcription factor.

Immunogen Nuclear receptor subfamily 4 group A member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen neuregulin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen neuregulin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

The gene NRP2 (neuropilin 2) is mapped to human chromosome 2q33. The gene encodes a single-spanning transmembrane glycoprotein.